PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN37783.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB
Protein Properties Length: 175aa    MW: 20282.7 Da    PI: 8.4637
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN37783.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding45.31.9e-141358348
                     SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +W+  Ede+l+++v+  G g+W+  +++ g++R++++ck rw++yl
       KHN37783.1 13 AWSSHEDEILLNYVQVRGEGNWRNLPKRAGLKRCGESCKQRWLNYL 58
                     8*******************************************97 PP

2Myb_DNA-binding51.22.8e-1664109148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg+ + +E+el+++++k+lG++ W+ Ia +++ gRt++++k++w++yl
       KHN37783.1  64 RGNISLDEHELIIRLHKLLGNR-WSIIAGRLP-GRTEEEIKNYWNTYL 109
                      788999****************.*********.*************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.041658IPR017930Myb domain
SMARTSM007179.6E-101060IPR001005SANT/Myb domain
SuperFamilySSF466894.79E-2612105IPR009057Homeodomain-like
PfamPF002491.1E-111258IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.1E-201365IPR009057Homeodomain-like
CDDcd001671.98E-71358No hitNo description
PROSITE profilePS5129423.00359113IPR017930Myb domain
SMARTSM007171.8E-1463111IPR001005SANT/Myb domain
PfamPF002492.8E-1464109IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.7E-2166112IPR009057Homeodomain-like
CDDcd001671.55E-968109No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 175 aa     Download sequence    Send to blast
METKDDSAEK EEAWSSHEDE ILLNYVQVRG EGNWRNLPKR AGLKRCGESC KQRWLNYLKP  60
TISRGNISLD EHELIIRLHK LLGNRWSIIA GRLPGRTEEE IKNYWNTYLR KEAEENQNNK  120
NEFPSTSMTT TSMSSVQSPW YSENSVGTNP TESPNPVIRP KVVRLSKFNL SCQDK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C2e-191411330128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ9028620.0DQ902862.1 Glycine max transcription factor MYBZ1 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001237452.11e-126transcription factor MYBZ1
SwissprotQ9FJA21e-48TT2_ARATH; Transcription factor TT2
TrEMBLA0A0B2RZH11e-127A0A0B2RZH1_GLYSO; Transcription factor TT2
STRINGGLYMA15G19360.11e-114(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF3633022
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13540.11e-47myb domain protein 5
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]